SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030994 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030994
Domain Number 1 Region: 349-439
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-22
Family DEP domain 0.0047
Further Details:      
 
Domain Number 2 Region: 233-316
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000636
Family Thioltransferase 0.025
Further Details:      
 
Weak hits

Sequence:  OsIBCD030994
Domain Number - Region: 32-39
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0785
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030994
Sequence length 705
Comment 705
Sequence
MGEETLVAMPLAPPHHHHHHAHLPALPHLAAPPPPPPPPAETELTEQREEEVPVDDVVEA
SADVPRREEGLVVDGGEDVYYARRMLQGVVLRPPPHLPQPEAPPGLTRALSAPAPDGYVE
EEEEQRPVERSASVNSAASAVVVDVASIGRFFRDRRDVLSSAITRRISSLKEASSSPPPP
VGMDTYGVQEIHLPNVKVTVRLKDAIEADAEEDDAVGGGGDDGYSFSGSHIKGRVSFFSR
SGCRDCAAVRAFFRQSALPYVEINLDVFPEREAEFASRAGASARVPQIFLNEKLLGGLVV
LNSLRNSGEFERRVRDLAGRRCPDTAPRVPVYGFDNDPGKEGGDREDAMVGIVRVLRHRL
PIQDRIVRLKLVKNCFSGADMVDGIVNHLECSRKKAVEIGRELARKHFIHHVFRENDFED
GSQNLYRFLEHDPAIPKYYNFIRGATNDGEPKLAAAIGQRMTKIMVAILEAYASDDRRHL
DYSRIAASEEFRRYANMVQELQRVDMSALPAEERLPFFLNLHNAMAIHAVVRVGQPGAID
RRSSFSNFQYVVGGHPYSLATIRNGILRSNRRQPYTIAKPFGSSDKRLELVQGKVNPLVH
FGLCDATRSSPIVRFFSTQGVEPELRHAAREFFLNGGVEIDLESRTVHLTRIIKWYSVDF
GQDRETLKWILNYLDPTKAGLLTHLLNDGGAINISYLNYDWSLNV
Download sequence
Identical sequences B8BHJ3
OsIBCD030994 39946.BGIOSIBCE032509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]