SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031006 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031006
Domain Number 1 Region: 1079-1230
Classification Level Classification E-value
Superfamily VC0467-like 1.83e-23
Family VC0467-like 0.0017
Further Details:      
 
Domain Number 2 Region: 911-1025
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000311
Family PDI-like 0.0049
Further Details:      
 
Weak hits

Sequence:  OsIBCD031006
Domain Number - Region: 43-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000847
Family PDI-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031006
Sequence length 1235
Comment 1235
Sequence
MRLPLLTAALPLLLSLLAASQLGASATAAAASSGAAASGRAEWQVLTRANFSSQIRLHPH
ILLVITMPWYGESRSLMAEIERLVAADEQELGHLKLMAVYRNSEKLLTDVLGATEGIKFI
YYQRSLPFKYEGKLRAREILSSVHYIMSLKHAEAPFVVLHTKEDVEAFVESTDKAVVLSE
FCGWFSKLAHGGSNRTEGTSSKNHTENVDISGKALTGESDGPLELVIEDEELIFGGGVQL
AGFPWKGGFTLANGSMSDQNGITTDENRKLCTAEKLQQFESFYAKLTALSRDYFLPPEKV
RFGLITERSSLPSSEFINEGNSETWFLSVHYLGCTNCSIVAKEGDDLRSLLQSYHNLNIN
EMDIDASGIATFPASRSSAILFIDRLSDSSKVRDESKLSLKLLREYVQKNYPSHFSTGGL
TSGKSRMSSKAVPSLVSTGRSAHTERTRLNDWASKLMEIGEKMSVMVVNDGESISYRSDS
QGSTDNPLYDILTKLIHKTRPAHRSKKTKISFVAKDVAIKKLSDDSEVQVVESLSIRDSQ
LERNEGSCASSDGGNDDYTEDSVHENRATEAEYINDRQAPIKLEKGPANYCDNNEKHLES
SDTEVEEEHKTKASDVSLDLQEDISVDVHSSNAPKNFCKINKEDLDCSDTKMEEQEHKTE
ASDTSADLQEEVSTDVHSSNEVGHILHKHKDEETVREALDILEPDGTNVNFNQQKSGSAN
QQDAVFSVLGQESRRIEDAIYEDNLFILDEGSEESDSKYPVHAALSSSSSLVGDNTYYTE
QETPSIPDEHFAGSLFFSDGGYRLLQTLTGGSRMPSLVIIDPIQQKHYVFPDEIEFTYPS
LANFLDHFMNRSLSPYYRSALSVISSKELLRPPFINRDFHEADSIPQLTTSNFCMLVFGF
EGCVSKSELPFSNTENIASAWKKDVLVLFSNSWCGFCQRTELVVREAQDLQIEEKEEEST
MKGFPAIYLIDCTSNECHHLLKSVGKEERYPTLLFFPAENKSAISYERGISVSNLFEFLE
SHASNSPHLLEYKGFLWKKKTVVQGDAPQAIQFDNSDKSSNDVGSHSPSHSERNEARVLT
GSVLTATSKLGSAVPFDNSQVLIVSADSREGFHGLIINKRLSWDTFKNLDGSMEPIKHAP
LFYGGPVVVQGYYLVSLSRVAFDGYLQVIPGVYYGNVAATAQVTRRIKSGEQSAENLWFF
LGFSNWEYSQLFDELSEGAWQVSEEPIEHLVWPEN
Download sequence
Identical sequences OsIBCD031006 39946.BGIOSIBCE032522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]