SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031103 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031103
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-41
Family Calponin-homology domain, CH-domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 197-253
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.1e-19
Family EB1 dimerisation domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031103
Sequence length 332
Comment 332
Sequence
MAASNIGMMDGAYFVGRNEILAWINTTLQLGLSKVEEAASGAVACQLMDAAHPGAVPMHK
VNFDAKTEYEMIQNYKVLQDVFNKLKITKHIEVNKLTKGRPLDNLEFMQWMKRYCDSVNG
GFMNSYNASERRESSKGGKETNRRTSVPSQAPAKSSSATHKAQALSHGAKKANGHAPNAP
PSRSAKPSPANSAGPAYDEQITELKLLVDSLEKERDFYFSKLRDVEILCQSPEVEHLPIV
NAIHKVLYAAEDDPSMVAEAQAMISQQQQSEQPMLSPILEASEERPAKQEAHKRKSISDL
ELEEFGMASSSRQRLSDISDVQLCGSPLTSFT
Download sequence
Identical sequences A2Z906
39946.BGIOSIBCE032636 OsIBCD031103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]