SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031222 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031222
Domain Number 1 Region: 346-462
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-25
Family UBX domain 0.0044
Further Details:      
 
Domain Number 2 Region: 146-293
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.5e-24
Family UAS domain 0.062
Further Details:      
 
Domain Number 3 Region: 2-41
Classification Level Classification E-value
Superfamily UBA-like 0.0000867
Family TAP-C domain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031222
Sequence length 465
Comment 465
Sequence
MAETVDDKVSYFQAVTGISDHDLCTEILAAHNWDLQLAVSSITANPSSPDPAPSAPPPPL
APREADLVAPHLPPPPQQQQQQQPGIAWKLVTLPFYVVSGGVGLIAGSIRLGAWVAGGVL
SRSLSILGLAQGGGGGGDRLLELPPSAAEAADFVAEFEREFGAGRGPHFVAEGFADALQR
AQREYKLLFVYLHSPDHPDTPAFCGGCLCAEPVAAFIDENFVAWGGSIRRTEGFKMSNSL
NASRFPFCAVVMASTNQRIVLLRQIEGPKSPEEMITTLQGAVEECSASLVAARIDAEERL
NNQRLREEQDAAYRAALEADQARERQRREEQEKREREAAEAERKRKEEEEAQERAAQEAA
EKEAALARRRQEKAMALGAEPEKGPDVTRVLIRFPTGERKERRFNSSTTITSLYDYVDSL
DCLKAEKYSLVSNFPRVTYGPEKLSQTLEEAGLHPQASLFIEIEQ
Download sequence
Identical sequences A2Z9E8
OsIBCD031222 39946.BGIOSIBCE032789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]