SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031262 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031262
Domain Number 1 Region: 88-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.48e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000956
Further Details:      
 
Domain Number 2 Region: 16-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.87e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031262
Sequence length 244
Comment 244
Sequence
MSSTNNSSGEPPPAVRVLGGWASPFTNRVVVALKLKGVEHELLQETVGKKSELLLRSNPV
HKKFPVLLHHGKPLPESLVIVEYIDEVWPASNGAASAILPRDPHGRAVERFWARYVDDKI
LPGLRVLRGSVTGDKYKTAGEMSTALQRLEEAFVKCSQGKEYFGGDSIGYLDIALGSFLG
WIKAVEKIAGVELLNETKLPILAVWADRFCAHPAVVDVVPDADKLVEFTVQYGAVLNTTN
VLPK
Download sequence
Identical sequences A2Z9J0
39946.BGIOSIBCE032825 OsIBCD031262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]