SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031264 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031264
Domain Number 1 Region: 87-233
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.09e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 17-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031264
Sequence length 243
Comment 243
Sequence
MSSSSTSGSAEPAAAVRVLGSWTSPFVMRVVVALKLKGVEYELLQETRGKKSELLLRSNP
VHKKIPVLLHHGKPLAESLVIVEYIDEVWPASDGAPAILPRDPYCRAVERFWAQYIDDKF
PRGTRVLRGTVAGDKDEVVVEMSTALQHLEAAFVKCSRGKEYFGGDNIGYLDIALGSFLG
WIKAVEKFAGVELLDEAKVPNLAAWVDRFCAHPAVVDAMPDADKLVEFAVKHAASMKALD
APK
Download sequence
Identical sequences A2Z9J2
39946.BGIOSIBCE032827 OsIBCD031264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]