SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031279 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031279
Domain Number 1 Region: 78-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.73e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 7-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031279
Sequence length 241
Comment 241
Sequence
MAGGDELKLLGAFPSAYVTRVELALGFKGLSYEYVKEDLANKSELLLSSNPVHKKVPVLI
HNGKPISESQVILEYIDEAFTGASLLTRDPYERAVARFWVAYIDDKLKVTIFWNGGVHYI
MVPNDTRKDEGGEGGGVEADVRGGRALKDSSKGKPFFGGDTVGLVDITLGSLIAWMKATE
VLTGAKIFDPAKTPLLAAWTERFAELDTTKKVLPDVAGYVEYVNKRRQTQAATAAVVASN
S
Download sequence
Identical sequences A2Z9K7
OsIBCD031279 39946.BGIOSIBCE032844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]