SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031280 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031280
Domain Number 1 Region: 88-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.47e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.00000349
Further Details:      
 
Domain Number 2 Region: 8-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.14e-27
Family Glutathione S-transferase (GST), N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031280
Sequence length 235
Comment 235
Sequence
MAGAGDELKLLGMWTSPFALRVKLALSFKGLSYEYAEEDLSNKSELLLSSNPVHKKVPVL
IHNGKPICESQVIVQYIDEAFPGAGVPLLPSDPYERAVARFWAAYIDDKLLKSWLQASMG
KTEEEKAEALKETFAAVANLEAAFEGCSKGKPFFGGDAVGYLDVTLGALVSWVHAGEALY
GMRLFDATRSPLLDAWVDRFAALDAAKAALPDAGRLAEYAKKRQAERAAGEAANN
Download sequence
Identical sequences A2Z9K8
OsIBCD031280 39946.BGIOSIBCE032845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]