SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD031288 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD031288
Domain Number 1 Region: 89-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.52e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.00000199
Further Details:      
 
Domain Number 2 Region: 8-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.92e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD031288
Sequence length 234
Comment 234
Sequence
MAGGGDELKLLATWFSPFASRVKFVFHLKGLSYENIEEDLKNKSDLLLKSNPVIKKVPVL
LHNGKPLCESMVIVEYLDETFAAVGPSVVPADPYERAVARFWVSYIDNKLVAPWFQVFRG
KTKEEKAEGLKQMFEATAVMEVAFRECSKGRPFFGGDAVGIVDVALGSQLGWLRASETLS
GIKLFDPAKTPLLLAWAERFLALDAAKASMPESGRLLAYAKMRQAETDAANASK
Download sequence
Identical sequences A2Z9L6
39946.BGIOSIBCE032853 OsIBCD031288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]