SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD032121 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD032121
Domain Number 1 Region: 41-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.11e-35
Family PDI-like 0.00092
Further Details:      
 
Domain Number 2 Region: 349-492
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.9e-35
Family PDI-like 0.003
Further Details:      
 
Domain Number 3 Region: 275-383
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.09e-20
Family Thioltransferase 0.059
Further Details:      
 
Domain Number 4 Region: 154-254
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000348
Family PDI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD032121
Sequence length 512
Comment 512
Sequence
MAISKAWISLLLALAVVLSAPAARAEEAAAAEEGGDAAAEAVLTLDADGFDEAVAKHPFM
VVEFYAPWCGHCKKLAPEYEKAAQELSKHDPPIVLAKVDANDEKNKPLATKYEIQGFPTL
KIFRNQGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKSPEDATNLIDDKKIYIVGIFSE
LSGTEYTNFIEVAEKLRSDYDFGHTLHANHLPRGDAAVERPLVRLFKPFDELVVDSKDFD
VTALEKFIDASSTPKVVTFDKNPDNHPYLLKFFQSSAAKAMLFLNFSTGPFESFKSVYYG
AAEEFKDKEIKFLIGDIEASQGAFQYFGLREDQVPLIIIQDGESKKFLKAHVEPDQIVSW
LKEYFDGKLSPFRKSEPIPEVNDEPVKVVVADNVHDFVFKSGKNVLVEFYAPWCGHCKKL
APILDEAATTLKSDKDVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGKMVPYESGRTAD
EIVDFIKNNKETAGQAKEKAESAPAEPLKDEL
Download sequence
Identical sequences A2ZCE6
OsIBCD032121 39946.BGIOSIBCE033828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]