SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD032213 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD032213
Domain Number 1 Region: 205-267
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000126
Family Glutathione peroxidase-like 0.013
Further Details:      
 
Weak hits

Sequence:  OsIBCD032213
Domain Number - Region: 39-102
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0641
Family Multidrug efflux transporter AcrB transmembrane domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD032213
Sequence length 288
Comment 288
Sequence
MVPGSATPNLVSHSQLWQWCPDWWHTARSPRQTSAGLSSHHTQPSAYAPPMLIFALVLVR
LHPCCALTSTRSPLFMFQLLFLALLTSLAFLFNTSAPITSVAKLRIAYFHVNNSLFPAVD
LTLCFSVHNLGLVLLLRYCVVSAAVSYHSHLVVSTNMSPRSAHPGCKLDAGAGGVPAQIL
ASRVRAIDVSLTLESLMVSGDLYFVVGKDGEKVPVAWLVGRTGLLYFSAHWCSPCRKFLP
KLIEEYIKMREETSSDVEVVFVSNTDGQEKRNCHVRPTAYILSFFTDM
Download sequence
Identical sequences OsIBCD032213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]