SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD032299 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD032299
Domain Number 1 Region: 106-235
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 24-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.86e-29
Family Glutathione S-transferase (GST), N-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD032299
Sequence length 240
Comment 240
Sequence
MASSGSPEARQTHGEIAGAAAPERRLKLYSFWRSSCSYRVRIALSLKGLDYEYKPINLLA
NEQSHPEFEKLNPMKYVPALVDGDDTVVVDSFAILLYLEDTYPQHPLLPQDPKMKALNIQ
IASIVGSSIQPFQNNSVLDFIEEKLDSQEKVNWIQYHLNRGFTALEKMLKGCTTTYATGD
EIQLGDLFLEPQIYGGIKRFGIDMTNYPTLARLHEAYMEHPAFQAALPERQPDAPSSPEI
Download sequence
Identical sequences A2ZD11
OsIBCD032299 39946.BGIOSIBCE034040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]