SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD032544 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD032544
Domain Number 1 Region: 8-122
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000224
Family spliceosomal protein U5-15Kd 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD032544
Sequence length 155
Comment 155
Sequence
MGSALLPTLRRKPEVDAAIRDTLDKVLVLRFGRADDAACLHLDDILAKSSWDISRFATVA
LVDMDSEEMQVYIDYFDITLVPATIFFFNAQHMKMDSGTPDHTKWIGSFSSKQDFIDVVE
NVLVYSSPQGLRYNHTAVRCMLWFVLVHQEGHDVP
Download sequence
Identical sequences OsIBCD032544 39946.BGIOSIBCE034230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]