SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD033413 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD033413
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 85-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.43e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD033413
Sequence length 246
Comment 246
Sequence
MQPLLKVYADRRSQPSRAIIIFCRVNRIDFEEVTVDLFKREHLSPEFKKINPMGQVPAIV
DGRFRLFESHAILRYLATVFPGVADHWYPADLFTRAKLEAILDWHHSNLRRGAATFILNT
VLAPSLGLPSSPQAAKEAEKVLFRSLGLIESMWLKGNAKFLLGNPQLSIADLSLVCEIMQ
LEVLGDSERDRILGPHEKIRSWVQNVKKATSPHFDEVHELIFKMKERMAAKRQSEPSKDL
KTASKL
Download sequence
Identical sequences A0A0E0J3P4 A0A0E0RAA8 A2ZG26 Q945X2
LOC_Os11g37730.1|13111.m03694|protein ONIVA11G18080.1 OsIBCD033413 XP_015617974.1.37577 39946.BGIOSIBCE035047 39947.LOC_Os11g37730.1 LOC_Os11g37730.1|PACid:21948538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]