SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD033910 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD033910
Domain Number 1 Region: 57-190
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.91e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.00048
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000386
Family Glutathione S-transferase (GST), N-terminal domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD033910
Sequence length 198
Comment 198
Sequence
MWALRIKGVEYDYIEEDLRNKSNLLLECNPVHKKVPVLIYQGKPIAESDVILEFIDDVWK
DLRYRILPEDPYECAMARFWSKFGLDKLSPPIWKWFTTQGKEQEDAYEAAMEQLLVLEKV
LDEKKFFGGERIGFVDLSLGSLSYVIPIYEDITGVRLITSDKFPWLSAWMEGFLGLPLVK
EHLLPLDKLRPSSSTSHC
Download sequence
Identical sequences A2ZHL9 A3CEH5
OsIBCD033910 39946.BGIOSIBCE035578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]