SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD033962 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD033962
Domain Number 1 Region: 523-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-70
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 753-898
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.74e-26
Family Protein kinases, catalytic subunit 0.0029
Further Details:      
 
Domain Number 3 Region: 69-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-23
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD033962
Sequence length 903
Comment 903
Sequence
MNSRLATFALLVIITLSSSPRPCPRRVDAAREWLARGASIAVEDHATDVLRSPDGTFAAG
FYDASPTVFTFSVWFARAADRAVVWTAARARPVHSKGARVTLDARRGALVLTDYGGEVVW
NSSTPAAGGSGGARVRLHDTGNLVVEDAGGKTLWQSFDFPTDTLLPAQRLTAATRLVSRD
RLLSAGYYSLGFSDYAMLSLFYDNGNFSSIYWPNPYFSYWQNNRKIYNFSREAAMDALGQ
FFSSDGTTFEAADLGAAGVRRRLTLDTDGNLRAYSLDDATGTWSVSWMAFGNPCNIHGVC
GANAVCLYSPAPLCVCAPGHERVDASDWSRGCRPTFRLECGRPAKLVALPHSDFWGYDLN
DGEVMPLGDCANKCLDNCACVVFQYKEHMECYLKSVLFNGKTFPGLPGTVYIKVPADFDV
PEFHVHQWQRGGDGGGGGLAIQEDIAGCAAAATGDSNRKVLLNVSSSLSSHDAGKPVWPY
LYGFLSALLVVEAIVIGFGCWLFSSKGLFRHSRVYAIDQEGYKLITSHFQRYTYADIKKA
TANFTGVIGRGGSGVVYKGVLDDERVVAVKVLKNVSRQSEEEFQAELSVIGRIYHMNLVR
MWGCCSQAKHRILVSEYIENGSLAQRLFDHGFDDDVLDWNQRFRIALGVAKGLAYLHSEC
SEWIVHCDMKPENILLDKDLEPKITDFGLSKLLNRDGSDAILTRIRGTRGYMAPEWVTNL
PFTEKVDVYSYGVILLELVKGIRISEWVIHGIKDLEPKITDFGLSKLLNRDGSDAILTRI
RGTRGYMAPEWVTNLPFTEKVDVYSYGVILLELVKGIRISEWVIHGIKVCEMDIRMVVRA
TRQKMESNEKRSIEDLVDYRLNGDFNHVQVKLMLEIAISCLEEDRSKRPNMNSVVQSLIS
VEG
Download sequence
Identical sequences B8BLW7
OsIBCD033962 39946.BGIOSIBCE035637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]