SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD034204 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034204
Domain Number 1 Region: 184-284
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.49e-30
Family Thioltransferase 0.00055
Further Details:      
 
Weak hits

Sequence:  OsIBCD034204
Domain Number - Region: 75-113
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0144
Family GIY-YIG endonuclease 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034204
Sequence length 285
Comment 285
Sequence
MATSSAAAALRLPASQLPLSARPSSSSTLRFPPRRPARRGGLAVSAFTKLSEASPVAIPP
EPAQPLPDEEALPPKPGVYGVYDPAGELQFVGISRNVRASVEGHRRKVPADLCGSVKVSI
ADEETPDRTVLTNAWKSWLEEHITATGKAPPGNVAGNHTWVGPPQRPPDLRLTPGRHVQL
TVPLEQLIDRLVKDNKVVAFIKGSRSAPQCGFSQRVVGILESHGVDFVTVDVLDEEHNHG
LRETLKTYSNWPTFPQVFVGGELVGGCDIVSSMAEKGELAALFKK
Download sequence
Identical sequences A0A0E0J7F4 A0A0E0REG8 A2ZIK9 Q2QX01
ONIVA12G04240.1 LOC_Os12g07650.1|13112.m00802|protein XP_015618330.1.37577 OsIBCD034204 LOC_Os12g07650.1|PACid:21937096 39946.BGIOSIBCE035923 39947.LOC_Os12g07650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]