SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD034360 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034360
Domain Number 1 Region: 311-439
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.56e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 230-314
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.5e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 58-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.87e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.001
Further Details:      
 
Domain Number 4 Region: 111-169
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000698
Family Glutathione S-transferase (GST), C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034360
Sequence length 441
Comment 441
Sequence
MAHDGGDHRGGGGRNSASGLNEKRSVRIALNLKVTSETSGRVYCLLLGWWIPFHALGGGI
DYEYRAVTRGDPDYGKINPIKYVPALVDGDFTISDSLAIILYLEDKYPQHPLLPQDLKKK
ALNMQGLADGKMSANESLQIVQHYTDKGFRAIEKLLEGCRSKYATGDEVQLWKSAFLQVS
MKYTHDIMHFKLHILKTNQMHLYPNNQDSKRAVYIDIHLLAEEEEQVPAMASSKPILYGA
WISSCSHRIRIVLNLKGVDYEYKSVNPRTDPDYEKINPIKYIPALVDGDLVVSDSLAIAL
YLEDKYPQHALLPKDLKKKALNLQIANVVCSSIQPLQGYAVIGLHEGKLSPDESLQIVQH
YIDKGFKAIEKLLEGSNFKYATGDEVQLGDVFLAPQIHAGINRFQIDITKYPILARLHDT
YMEIPAFQAALPKNQPDAPSC
Download sequence
Identical sequences 39946.BGIOSIBCE036063 OsIBCD034360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]