SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD034571 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034571
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.77e-23
Family Thioltransferase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034571
Sequence length 123
Comment 123
Sequence
MVCGKLVVIEFGASWCEPSRRIAPVFAEYAKEFAGVVFLKFDIDELEEIADSYDVNGVVP
TFTFVKAGQKIDMIQGARNNGEDKETLGEGLRVMEDHQGRPSQGGGPKQANFECNSEFKT
SLH
Download sequence
Identical sequences OsIBCD034571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]