SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD034572 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD034572
Domain Number 1 Region: 207-475
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.79e-47
Family G proteins 0.091
Further Details:      
 
Domain Number 2 Region: 867-1027
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.4e-20
Family Thioltransferase 0.00038
Further Details:      
 
Domain Number 3 Region: 540-804
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000816
Family Ngr ectodomain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD034572
Sequence length 1033
Comment 1033
Sequence
MAPAVSASQGVIMRSLTSKLDSLLLQPPEPPPPAQPSSLRKGERKKILLLRGDLRHLLDD
YYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAK
KMISSMIARLRGELNRRRWIADEVTLFRARVKEAIRRHESYHLGRRTSSSRPREEDDDDD
REDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGV
GKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEV
DRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCG
YNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARH
FKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKE
DYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVV
HHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRS
MAFFGQVKCMPSIADYRLLRVLILCFWADQEKTSYDLTSISELLQLRYLKITGNITVKLP
EKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKL
NNLRILNIAVMQISQDDLDTLKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCT
APCMTFVEGAMPSVQRLNLRFNANEFKQYDSKETGLEHLVALAEISARIGGTDDDESNKT
EVESALRTAIRKHPTPSTLMVDIQWVDWIFGAEGRDLDEDLAQQDDHGFCMLPESSSRLQ
SREISIEEDMPTGAEGTVIVPHTMEQFALHMSQAKQSHKLVVIQFTTSRCPASRYIAPAF
TEYAKEFAGAVFIKVNVDSDELESVTDWYDIEGIVPTFFFVKDGEKIDKIPGANKELLRA
KIRRHTASPYFLR
Download sequence
Identical sequences B8BP45
39946.BGIOSIBCE036248 OsIBCD034572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]