SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD037451 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD037451
Domain Number 1 Region: 62-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.48e-37
Family Glutathione peroxidase-like 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD037451
Sequence length 225
Comment 225
Sequence
MAAPTAAALSTLSAASVTSGKRFITSSFSLSFSSRPLATGVRAAGARAARRSAASASTVV
ATIAVGDKLPDATLSYFDPADGELKTVTVAELTAGRKAVLFAVPGAFTPTCSQKHLPGFI
EKAGELHAKGVDAIACVSVNDAFVMRAWKESLGLGDADVLLLSDGNLELTRALGVEMDLS
DKPMGLGVRSRRYALLADDGVVKVLNLEEGGAFTTSSAEEMLKAL
Download sequence
Identical sequences A0A0E0G369 A2X1X4
ONIVA02G08670.1 OsIBCD037451 39946.BGIOSIBCE005969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]