SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD039234 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD039234
Domain Number 1 Region: 86-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.65e-39
Family Glutathione S-transferase (GST), C-terminal domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.24e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD039234
Sequence length 228
Comment 228
Sequence
MEGEKKSVVLINCAVSMYGNRVRIALARKGVAYEEKPENLAAKSALLLSSNPVHGQVPVL
LVGGKPVCESLVILEFIDEAFAGVGEPLLPAGPYERAQARFWASYIDAKLAPCAARVWRS
PAGAAAVVEAARDELVAAMRTLEAELGGKRYFGGEVVGYVDVALAPFTAWFATYERFGGF
SVAAECPALAAWAARCARENACVAASLPDPEFVYQFACGMRKHFGLDG
Download sequence
Identical sequences A0A0E0NYT0 A2XK19
OsIBCD039234 39946.BGIOSIBCE012268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]