SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD041823 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD041823
Domain Number 1 Region: 109-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.93e-18
Family Thioltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD041823
Sequence length 285
Comment 285
Sequence
MAGLDYDDEEEEEEEEVVVDGHGGERQVKSAPGSPAFDPDVLAAFRKAVEELPPESPPRD
AAAAADDDDNKKGEIQKFPGVVRARIILFQKEIDAKLAKKAPPPPPPESARRVVVYLTSL
RGIRQTYEDCCATASILRSYGVRVDERDLSLHAGYKDELRAALGDGAGGGGGVPGQGRPL
PQVFVDGCHVGGAEDVRRMHESGELTGTLLKACDTAAAAVAAVGKGGRQLAPPSEPCGGC
GGVRFVPCDACSGSCKVFVADDEDGGAFRRCPECNENGLVRCPVC
Download sequence
Identical sequences A2YAW7
OsIBCD041823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]