SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD041825 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD041825
Domain Number 1 Region: 16-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.71e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 97-247
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.72e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD041825
Sequence length 259
Comment 259
Sequence
MAMTTAAVAAAAQPKEVKLYGAWGSAHAAMARNALELKGVRYEYVEEDLERKSETLLLRL
NPAHAGKVPVLVVVDDDGGGGGCPLAESLVILEYVDEVWPQAPRLLPPPSSPRARAAARF
WARFFHGEVSPLSRAAAVLAPTPEERAEAVREMKARMAVMEAGFERDFPSSVVGGPFVHG
ATPGLLDVILGSCAAGTRAISAMAGEEVVEPDALPHVHASMAAFDERVAGFGTSVPHELL
LARLLEREERRRAAASASA
Download sequence
Identical sequences A2YAX5 Q6QHA4
LOC_Os06g12290.1|PACid:21929629 XP_015641268.1.37577 39946.BGIOSIBCE021205 39947.LOC_Os06g12290.1 LOC_Os06g12290.1|13106.m01343|protein OsIBCD041825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]