SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD042325 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD042325
Domain Number 1 Region: 70-232
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-38
Family Glutathione peroxidase-like 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD042325
Sequence length 232
Comment 232
Sequence
MAAAASTLASLSATAAAAAGKRLLLSSPSRSLSLSLASRGRIAVMPHLRAGILSAAPRRA
VSASAPAAATIAVGDKLPDATLSYFDSPDGELKTVTVRDLTAGKKVVLFAVPGAFTPTCT
QKHVPGFVAKAGELRAKGVDAVACVSVNDAFVMRAWKESLGVGDEVLLLSDGNGELARAM
GVELDLSDKPAGLGVRSRRYALLAEDGVVKVLNLEEGGAFTTSSAEEMLKAL
Download sequence
Identical sequences A0A0D3GIU4 A0A0E0AC28 A0A0E0Q0C3 A2YF78 I1Q3R7 Q69TY4
OBART06G21500.1 OsIBCD042325 39946.BGIOSIBCE022688 39947.LOC_Os06g42000.1 XP_015640940.1.37577 OGLUM06G22650.1 LOC_Os06g42000.1|13106.m04392|protein ORGLA06G0178000.1 LOC_Os06g42000.1|PACid:21932316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]