SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD042652 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD042652
Domain Number 1 Region: 96-230
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.66e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 13-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.45e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD042652
Sequence length 235
Comment 235
Sequence
MAAGAGGDGGGELKLLGTWASPFVQRVRLALNLKGLAYEFIEEEIGGGKSELLLASNPVH
KKVPVLLHRSNPICESQVIVQYLDDAFPGGAAGGDLLPSDPHARAVARFWAAYIDAEFFA
PWNRSFYTASEEEKTAEMGRAAAALATIERAFAELSRGKGFFSGEDRPGFVDVVLGGFVG
SMRAYGTAVGVEVLDAGRTPLLVAWAERVAALDAARGVIPDVERVVELSRYARKK
Download sequence
Identical sequences A0A0E0HX40 A0A0E0Q4J4 A2YIJ4 Q69LE6
ONIVA07G03000.1 39946.BGIOSIBCE023833 39947.LOC_Os07g07320.1 LOC_Os07g07320.1|PACid:21899879 OsIBCD042652 XP_015647678.1.37577 LOC_Os07g07320.1|13107.m00713|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]