SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD042888 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD042888
Domain Number 1 Region: 142-286
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.99e-25
Family UAS domain 0.0003
Further Details:      
 
Domain Number 2 Region: 314-393
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000243
Family UBX domain 0.05
Further Details:      
 
Weak hits

Sequence:  OsIBCD042888
Domain Number - Region: 4-42
Classification Level Classification E-value
Superfamily UBA-like 0.00224
Family TAP-C domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD042888
Sequence length 395
Comment 395
Sequence
MENDARLLEFMEVTSCYDVTLAARQLASCGWHLDRAVDLFYAGVVEGGGRPSSWSARHDG
EESTSSASASTSVRAPISARSDTLYGVPYPSVGRATRRRRQTRWESEEDAALRRQREGEA
STSTSGYGGGRDDSDDEQPPPASKKRKPSTLAELYRAPRELTYRGGFHSAKVHAARLSRW
LLVNVQAEYGGREFASHLLNRDVWADETVAMYVRDNFVFWQADEGDSGGEGSKVYCYYKL
DRAKLPAVLFVDPVTGQLMEKLHHITDPTDFLMAAEKFIDSKSFISTTTRANRITAPLPP
PYRNHQKTPAATAAAKVCKLRVRFPDGQVVGKEFGGQCWVDALFAYCRSVIGVEQPFRVM
RMPATTGGKEEVREDKDVSFEQLGLNMSTVYVLLD
Download sequence
Identical sequences A2YKE1
39946.BGIOSIBCE024468 OsIBCD042888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]