SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD042982 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD042982
Domain Number 1 Region: 80-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.55e-41
Family Glutathione S-transferase (GST), C-terminal domain 0.00000967
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.49e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD042982
Sequence length 236
Comment 236
Sequence
MAGGDRLVLLDFWASPFGQRCRIALAEKKLPYDYSEQELLGAKSDLLLRSNPIHAKVPVL
LHGDGRAVCESLAILEYLDDAFPDATPRLLPSAAADPYARARARFWADYVDKKVYPVGTR
LWKVKGDDEEGVRAAVAAARGELVEALRTLDGELGEKEFFGGEEEFGLVDVALVPMMPWV
YSFARYGGFNVEEECPRVAAWARRCMERDSVAGSLRSPEEIYDFIGLLRKHYGIDD
Download sequence
Identical sequences A2YL42
OsIBCD042982 39946.BGIOSIBCE024695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]