SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD045448 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD045448
Domain Number 1 Region: 84-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.41e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.38e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD045448
Sequence length 238
Comment 238
Sequence
MASPAPAPVKVIGTFDSPYSHRAEAALRLKGVPYELILEDLRNKSDLLLTHNPIHKKVPV
LLHGDDDHRAAVCESLVIVEYVDEAFPAPLLLLPADPGLRAAARFWARFIDDKCTKPFWL
ALWSTNDGEVREGFAAEIKENLKLLEAQLKGRRFFGGDAIGYLDLAASGYAYWLEVLEEV
AGVSLVTGDEFPDLCRWAKEYAADDRIKACLPDRAKLLEHFTAMKEMFMATARSMAAK
Download sequence
Identical sequences A2Z939
39946.BGIOSIBCE032670 OsIBCD045448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]