SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD045505 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD045505
Domain Number 1 Region: 88-119,151-249
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.68e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 8-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.65e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD045505
Sequence length 264
Comment 264
Sequence
MAGKDDDVKVLGVVVSPFAIRVRIALNIKGVSYEYVEEDIFNKSELLLTSNPVHKKVPVL
IHGGKPISESLVIVQYVDEVWAAAPSVLPADPYDRAVARFWAAYVDNNVSTVLYTVLAMA
MSPKLFDEQLLVISLVVLQMFPGMAGVLFAATEEERAAKAEETLAALAQLEKAFAECAGG
KAFFGGDSIGYVDLVLGSNLHWFEALRRLFGVALLDAGKTPLLAAWAKRFVEAEAAKGVV
PDAGVAVELGKKLQARAAAASTAA
Download sequence
Identical sequences A2Z9L9
OsIBCD045505 39946.BGIOSIBCE032856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]