SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD046250 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD046250
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.2e-22
Family Thioltransferase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD046250
Sequence length 109
Comment 109
Sequence
MAERVARLASERAVVVFTKSGCCMSTAVTTLLGELAVSAAVHELDREPLGKEMEKELARR
LYGSGGRGGPAVPAVFIGGSLVGGTSKVMAMHLKGELVPLLKSAGALWL
Download sequence
Identical sequences A0A0E0F891 A2ZGI2 I1R1V8
39946.BGIOSIBCE035208 OsIBCD046250 OMERI11G17740.1 ORGLA11G0175000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]