SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047047 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047047
Domain Number 1 Region: 130-251
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.75e-24
Family Glutathione peroxidase-like 0.0054
Further Details:      
 
Domain Number 2 Region: 316-391
Classification Level Classification E-value
Superfamily Single hybrid motif 2.22e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047047
Sequence length 391
Comment 391
Sequence
MAEFRPHLGGAVWYGTATRLSDIYLQLFCDDCKSAEIALIDHHVDYEPRTVTGFHGESVE
ALSLSSHAPGLGETVGVHLLVYDLDDLRGALRPDARGRVPRGDARAPHATVSGAEAALWG
MRFDAPQPGSPALDMQAFRGRPLLVNFWATWCPPCVEELPMLNTFYRTQQARGWQVVGLA
IDQPSSVRQFLARVPVDFPIGLAGLQGTDLGRSLGNLAGGLPFTVLLGADGTIMHRVGVP
MDLRKLKTLIDLVSESNVSELEITEAEGKVRIVKSGGAVVQQFVAAPAPAPVAPAPAAAA
PAPVAELPAPSAPTGHIVKSPMVGTFYRASSPGAKAFVEVGSQVKEGDTICIIEAMKILN
EIEADKSGTVTRILGENGQAVEYGQPLFVIE
Download sequence
Identical sequences OsIBSD047047 39946.BGIOSIBSE038289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]