SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047165 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047165
Domain Number 1 Region: 629-789
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 3.92e-38
Family Succinyl-CoA synthetase domains 0.00032
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.23e-37
Family Thioltransferase 0.0019
Further Details:      
 
Domain Number 3 Region: 467-628
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 8.77e-35
Family Succinyl-CoA synthetase domains 0.00012
Further Details:      
 
Domain Number 4 Region: 823-1032
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.43e-28
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.046
Further Details:      
 
Domain Number 5 Region: 956-1020,1065-1203
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.32e-24
Family N-acetyl transferase, NAT 0.0042
Further Details:      
 
Domain Number 6 Region: 364-477
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.62e-22
Family CoA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047165
Sequence length 1224
Comment 1224
Sequence
MNTVCAACNATNRVPEERLADNAKCGRCGHELFDGEVINATAATLDQLLQDDLPVVVDFW
APWCGPCRSFAPIFEDVAEERAGKVRFVKVNTEAEPELSARFRIRSIPTIMVFRQGKMVD
MLNGAMPKAPFDNWLNEIVMTDNAVLRLRQFRLDRATRPFLARGCRVARCQGCLLPHKNC
LCDTIRPQQASSRFCLIMFGAEPLKPSNTGRLIADILPDTQAFLWSRTEVDSALLAAIND
PTRQPYVVFPASYADAERPVFSELPVGGKPPLFIMLDGTWAEARKMFRKSPYLNQFPVFS
LNVDAASAYQLREASRAEQHCTAEVAAALLQQAGDMPAADGLNQHFRYFRQQYLAGKPTR
PEAPQPGRAGNLMMSNLLAGGFGGPILPVTPRYKAVCGVMAYPDVASLPLTPDLAIICTH
ASRNLALIEALGQRGCKTAIVLSSPPEQFAELKACAQRYAMRLLGPNSLGLLAPWQGINA
SFSPVPIQKGKLAFISQSAAVANTILDWAQQREVGFSYFIALGDSLDIDVDDLLDFLARD
SKTSAILLYLENISDARRFLSASRSASRNKPILVIKSGRSQQAQLLLNSQLGLDAAYDAA
IQRAGLLRVQDTHELFSAVETLSHMHPLRGERLMIVSNGAAPAAMALDELLGRNGKLATL
SEESLATLSDALPDFIRAGNPLDLRDDATPQRYLAALEALLDSHDYDALLLIHAPSAAAP
GTATAQRLIDALHRHARGKRITLLTNWCGEYSSQEARRLFTEAAIPTYRTPEGAVTAFMH
MVEYRRNQKQLKETPALPVGLTANTADAHRLIHQALAEGATQLDTHEVQSILQAYDLSTL
PTWIAEDSAEAVHIAEQIGYPVALKLRSPDIPHKSEVQGVMLYLRTATEVQRAAEAILDR
VKRTYPQARIHGLLVQSMANRAGAQELRIAVEQDAIFGPLIMLGEGGVEWRQENQVAVAL
PPLNMALARYLVLQAVKGGKIRGRSALRPLDIPGLSRLLVQVSNLILDCPEIARLDIHPV
LASGSEFTLLDVSMQLAPFSGDPQARLAIRPYPHELEETIALKDGSQCLFRPILPEDEPA
LKHFIDRVTKEDLYYRYFSEINEFTHDDLANMTQIDYDREMAFVAVRADEIIGVTRALSD
PDNTDAEFAVLVRSDLKGVGLGRQLLEKMIAYARAHGLTRLSGITMPNNRGMIALAQRLG
FGIEVQLEDGIVNLTLPLQADDAQ
Download sequence
Identical sequences 39946.BGIOSIBSE037951 OsIBSD047165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]