SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047334 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047334
Domain Number 1 Region: 499-657
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.42e-32
Family DsbC/DsbG C-terminal domain-like 0.00000818
Further Details:      
 
Domain Number 2 Region: 279-424
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.31e-30
Family DsbA-like 0.093
Further Details:      
 
Domain Number 3 Region: 433-491
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.0000000000000811
Family DsbC/DsbG N-terminal domain-like 0.00016
Further Details:      
 
Domain Number 4 Region: 150-250
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000189
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047334
Sequence length 662
Comment 662
Sequence
MFATLLATPCSAPFLGTAVAFALGAPLHALWLIFLMLGVGMSLPWLFVALVPKTAMLLPK
PGRWMNTLKAILGLMMLASSLWLVTLLSLHLGAMVSQIVVLVLIVVALVLFALKGQTSSP
LFWIVVIALSAFGGYQLRGVFTSPPDAPAQHIAETIPWQPLSEDAIQQALSQGKRVFVDI
SADWCVTCKVNEHRVLNQPDIIAALSQPDVVALRSDWSQPSVFIADFLAKRNRYAIPFNA
VYGPGLPEGEILSPLLDKRTLAMAAQPLTPDQEQRAQKMIADFLFNDPNSPRIGAKNPKL
TLVVFTDYNCPYCKKFDPYLEKIVEKHPDVAVVFKFLPYRSESSLTAARDALTLWRQDPG
EFMKLNNTLMAKKGYHDDASIQEAQKRAGVSVTTPDEESLMTIKRSLLVAEKMGIQGTPA
TLIGLVQAADAIPDVVKHFSEQQNITIIKKLDAPGGAPAWLGQYQDMGVTLFLTPDGKHV
ISGYLYDDKGKNLSEGYFQKEIYAPMGREMWKTLNAAHPLKEGADNAPRKVFVFADPFCP
YCKQFWSEAQPWVKAGKVQLNTLLVAFLNPNSGRNAAAILNAKDPVSAWREYELSGGKKL
PKPEGEGSRETVAILQKHQALMDSLGANATPAIYYMNAENELQQVVGMPDAQQLEAMFGP
KP
Download sequence
Identical sequences OsIBSD047334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]