SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047525 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047525
Domain Number 1 Region: 29-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-32
Family Glutathione peroxidase-like 0.0021
Further Details:      
 
Domain Number 2 Region: 187-307
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.83e-25
Family N-acetyl transferase, NAT 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047525
Sequence length 319
Comment 319
Sequence
MGLKHWIGAAAVAAFVGVGAFVFLGAGRSQAPESTFVLLDGSRQTTADLRGKVTLVNFWA
TSCTTCVAEMPQIVSTYGKYRDRGFDTLAVAMSYDPPSYVVNFAQTRQLPFKVAIDNTGS
VARAWGDVQLTPSTFIVNKRGEIVKSYVGAPDFAELHHPPIALLHALPSPPQMEPVRAIF
REYGDSLGIDLEFQGFDAELAGLPGDYAPPRGQILLAEVDGAIAGCCALRPLDTADYPNA
AEMKRLYVRKAFRGFGLGRQLAEAMLDVARQAGYACVLLDTLVGMESARALYADLGFEEI
PPYYHNPIAGSHYLKVDID
Download sequence
Identical sequences OsIBSD047525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]