SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD047597 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD047597
Domain Number 1 Region: 116-271,385-466
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.92e-57
Family Bacterial dinuclear zinc exopeptidases 0.00000142
Further Details:      
 
Domain Number 2 Region: 10-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.44e-31
Family ArsC-like 0.0000548
Further Details:      
 
Domain Number 3 Region: 272-381
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 4.64e-29
Family Bacterial exopeptidase dimerisation domain 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBSD047597
Sequence length 468
Comment 468
Sequence
MANKPQQTTLTMYGIKNCDTIKKARRWLEDQGVAYHFHDYRADGLDEQRLRGFVAQLGWE
PLLNTRGTTWRKLDEAQRNACDNADAAIALMLAQPAIIKRPLLDAGNGRALLGFNADAYQ
QFIAEVAAIGFTVEAMDFEDTQNFWAWRGEGQTLAFAGHTDVVPTGDEKRWDNPPFEPAI
RDGMLYGRGAADMKGSLAAMVVAAERFVAANPNHRGRLAFLITSDEEASATHGTVKVVEA
LMARNERLDYCLVGEPSSTERVGDVVKNGRRGSITANLHIHGVQGHVAYPHLADNPVHRA
MPALNELVAIEWDRGNEFFPPTSMQIANVQAGTGSNNVIPGDFYVQFNFRFSTELTDAMI
KQRVEELLERHQLNYSIEWRLSGQPFLTSRGALVDAVVNAVEHYSELTPQLLTTGGTSDG
RFIAQMGAQVVELGPVNATIHKVNECVNAADLQLLSRMYQRIMEQLIA
Download sequence
Identical sequences OsIBSD047597 39946.BGIOSIBSE037870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]