SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048147 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048147
Domain Number 1 Region: 276-403
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.67e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 1-213
Classification Level Classification E-value
Superfamily HAD-like 3.31e-28
Family Phosphoserine phosphatase 0.0073
Further Details:      
 
Domain Number 3 Region: 211-289
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.61e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048147
Sequence length 410
Comment 410
Sequence
MDLALFDLDETLIDDDSASLWSRWLVGQGFAPAELELQEQQLMQLYYQGKLSMEDYMQAT
LAPLAGLSVQTVAGWVQRYIRRDILPRVYPAARERLQWHRERGDCILVISATGEHLVAPI
AEQLGADDALAIGVEISDGRFTGNTYGTMTYQQGKVIRLQHWLAQHPHLKFEHSHGYSDS
LNDKAMLQFVDSATVINPDSELSALAAERGWENSNNVRKVLWCAAELGLNYTHINAGGAF
GKVNEESYRALNPNGLVPLLQDDDFVLWESNTIVRYLAAKFGDATFYPQDLQARAAAEKW
MDWTTSTIVPAFTIVFWGLIRTAPELRDMAKIETAIATLEKHFDVIEQTLAHQPYLSGGA
FGFGDIPLGSFAYAWFEMPIARRPRPNMERWYQQLRARPAYQRGVMSALT
Download sequence
Identical sequences OsIBSD048147 39946.BGIOSIBSE037843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]