SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048206 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048206
Domain Number 1 Region: 247-341
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000973
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048206
Sequence length 346
Comment 346
Sequence
MPCVFPVLAIKVAGFARHGQDRRAHRLGGIAYTAGVVLSFLALGGAMLALRAAGEAVGWG
FQLQSPAVVAVLAALFTLIGLNLSGVFEFGRMLPSSLAGLQARHPVADAFLTGVLAVAVA
SPCTAPFMGASVGLTATLPAAQALAVFAALGIGLALPYLAASWVPAVARALPRPGAWMDT
LRRFLAFPMFATVVWLVWVLGQQSGIDGAAALLALLVALGMVVWACTLAGRARLALAPLS
LAVFAALAVAAGRPVFVDYTAAWCVTCQFNKKTTLASDAVLREFAGRNVALLRADWTRRD
PAITAALAQLGRSGVPVYVLQAPGRQPVVFSEILGERELRTALAAL
Download sequence
Identical sequences OsIBSD048206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]