SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD048878 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD048878
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.81e-35
Family Glutathionylspermidine synthase substrate-binding domain-like 0.00000815
Further Details:      
 
Domain Number 2 Region: 113-230
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-34
Family Glutathionylspermidine synthase ATP-binding domain-like 0.0000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD048878
Sequence length 236
Comment 236
Sequence
MQDNDVEEDYHALFIQRSLLQAGFETKILHGLGALSWDAAGQLIDDEGRHVNCVWKTWAW
ETAIEQIREVSETEYAAVPIRTGHPEGEVRLIDVLLRPEVLVFEPLWTVIPGNKAILPVL
WQLFPNHRYLLDTDFEVNDLLKQTGYAVKPIAGRCGSNIDLISAQDELLDKSSGKFIDRK
NIYQQLWCLPNVDGKYIQVCTFTVGGNYGGTCLRGDDSLVVKKESDIEPLIVVKDK
Download sequence
Identical sequences OsIBSD048878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]