SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD049191 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD049191
Domain Number 1 Region: 12-226
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.99e-52
Family DsbA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD049191
Sequence length 227
Comment 227
Sequence
MSTVPPPSSSAIPLRVDFVSDISCPWCAIGLQSLGRALDALQGSVQAELHFQPFELNPQM
PPGGQDIGEHLAEKYGASPEQTAQTQRAIAERGAALGFEFRMDRRSRIYNTFDAHQLLHW
AHETAGPQAQEALKRALFHAYFTEGRDPGDRALLLQLAAGAGLDAARAQQALESGEYADA
VREREAFYQQHGIHSVPAVIVNERHLIQGGQPPEVFEQALRQIAAQG
Download sequence
Identical sequences OsIBSD049191 39946.BGIOSIBSE038569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]