SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBSD049307 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBSD049307
Domain Number 1 Region: 122-261
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 7.55e-25
Family Single-domain sulfurtransferase 0.0088
Further Details:      
 
Domain Number 2 Region: 457-570
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.65e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.0054
Further Details:      
 
Domain Number 3 Region: 371-448
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.72e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBSD049307
Sequence length 587
Comment 587
Sequence
MAAARLRDGRRTRRAAGVPGRGAVAPPYHPRPMSQILTAALYHFATLPDCEALRGPLQAE
CDRHGVRGLLLLAPEGVNGTIAGTAEGVRAVLAMLRAQPPLAALRHKEAWGDRMPFYRMR
VRVKREIVTLGVPGVDAARDAGTYVKPGDWNALIDDPEVVVIDVRNGYESAIGSFTRAVR
PETRSFTEFPAWVEAQTAPGGLLAGKPRVAMFCTGGIRCEKSTALLRMQGFGEVYHLEGG
ILQYLEDVPAEGSRWEGDCFVFDERVSVSHGLVPGTHRHLCRSWRMPLGPQDLASPDYLP
GVRCPHCRGTRPAEEERALAERERQMALARERGTEHLGARLPTPPRAGPVSGCAAQDHGT
GPAEADASLPVLYSFRRCPYAIRARMAIAASGQRCEWREVVLRDKPAALLAASPKGTVPV
LVLPGGRVLEQSLDIMRWALAQHDPAGWLQAGEPGDVEALIASCDGPFKQALDRCKYPER
HPEVPSGAAQSQAREWLEGLEDRLARGDFLCGSRGSLADVALMPFVRQYAAIDRTAWGSR
PWPRLQAWLAAWESGALFEQVMHKAPAWREGQDVHYFPPGQARDRAA
Download sequence
Identical sequences OsIBSD049307 39946.BGIOSIBSE038592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]