SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000056 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000056
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily POZ domain 3.02e-29
Family BTB/POZ domain 0.00079
Further Details:      
 
Domain Number 2 Region: 432-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.43e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 411-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000141
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 368-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000955
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000056   Gene: ENSPPYG00000000059   Transcript: ENSPPYT00000000063
Sequence length 522
Comment pep:known_by_projection chromosome:PPYG2:1:5148794:5150362:-1 gene:ENSPPYG00000000059 transcript:ENSPPYT00000000063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKR
DIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIVKVCKKKLKEK
ASTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDEKLNILPSKRDLAAEP
GNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVL
DLSVKSSLSGVENLNSSYFSSQDVLRSKLVQVKVEKEASCDESDVGTNDYDMEHSTVKES
VSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESERVQVEGGMESSLLPYVS
NILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPTCSLCGKTFS
CMYTLKRHERTHSGEKPYTCTQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGD
LYRHIRKFHCELVNSLSVKSEALSLPTVRDWTLEDSSQELWK
Download sequence
Identical sequences H2N389
9600.ENSPPYP00000000056 ENSPPYP00000000056 XP_009245454.1.23681 XP_009245481.1.23681 ENSPPYP00000000056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]