SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000068 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000068
Domain Number 1 Region: 10-180,282-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.1e-48
Family FAD-linked reductases, N-terminal domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000068   Gene: ENSPPYG00000000070   Transcript: ENSPPYT00000000075
Sequence length 486
Comment pep:known chromosome:PPYG2:1:7663070:7724819:-1 gene:ENSPPYG00000000070 transcript:ENSPPYT00000000075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVANFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSTIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEERMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSLCLPAFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLMHYMSPRPFLRLRRPWNWIAHFWNTTCFPTKAMDSLEQI
SNLISR
Download sequence
Identical sequences H2N3A1
XP_009246968.1.23681 9600.ENSPPYP00000000068 ENSPPYP00000000068 ENSPPYP00000000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]