SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000270 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000270
Domain Number 1 Region: 68-537
Classification Level Classification E-value
Superfamily Sema domain 1.44e-128
Family Sema domain 0.000023
Further Details:      
 
Domain Number 2 Region: 1379-1508,1704-1892
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 980-1069
Classification Level Classification E-value
Superfamily E set domains 1.98e-18
Family Other IPT/TIG domains 0.054
Further Details:      
 
Domain Number 4 Region: 1068-1171
Classification Level Classification E-value
Superfamily E set domains 3.82e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 884-981
Classification Level Classification E-value
Superfamily E set domains 0.00000000000152
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 540-591
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000667
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1168-1249
Classification Level Classification E-value
Superfamily E set domains 0.0000000798
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 836-870
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000458
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000270   Gene: ENSPPYG00000000261   Transcript: ENSPPYT00000000286
Sequence length 1923
Comment pep:known_by_projection chromosome:PPYG2:1:41892297:42105572:1 gene:ENSPPYG00000000261 transcript:ENSPPYT00000000286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRESCEGQAGKVEQMSTHRSGLLTTAPLSMEQRRPWPRAPEVDSRSVVLLSVVWVLLAPT
AAGMPQFSTFHSENRDWTFNHLTVHRGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDN
KSCYPPLIVQPCSEVLTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEP
SHKKEHYLSSVNKTGTMYGVIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSA
MLDYELHSDFVSSLIKIPSDTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSA
GDLFYTSRIVRLCKDDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKPGDSLAQAFNITSQ
DDVLFAIFSKGQKQYHHPPDDSALCAFPIRAINLQIKERLQSCYQGEGNLELNWLLGKDV
QCTKAPVPIDDNFCGLDINQPLGGSTPVEGLTLYTTSRDRMTSVASYVYNGYSVVFVGTK
SGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSIDQRYLYVMSERQVTRVPVESC
EQYTTCGECLSSGDPHCGWCALHNMCSRRDKCQQAWEPNRFAASISQCVSLAVHPSSISV
SEHSQMLSLVVSDAPDLSAGIACAFGNLTEVEGQVSGSQVICISPGPKDVPVIPLDQDWF
GLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQ
EGRINISEDCPQLVPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVP
ALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESC
GLCLKADRKFECGWCSGERRCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPE
GGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVR
LCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGN
QTCEFYGRSMSEIVCVSPPSSNGLGPVPVSVSVDRARVDNNLQFEYIDDPRVQRIEPEWS
IASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLD
TVERPDEFGFVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCP
PASGGAKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISD
SLLTLPAIVSIAAGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKE
AFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKA
LKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSD
LIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEK
GPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEK
ILDAVYKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSD
RSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKV
WHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPL
AIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACL
SVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNA
YLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMS
IES
Download sequence
Identical sequences H2N3U5
ENSPPYP00000000270 ENSPPYP00000000270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]