SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000451 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000451
Domain Number 1 Region: 5-362
Classification Level Classification E-value
Superfamily TROVE domain-like 7.19e-135
Family TROVE domain-like 0.000000000024
Further Details:      
 
Domain Number 2 Region: 364-535
Classification Level Classification E-value
Superfamily vWA-like 3.81e-51
Family RoRNP C-terminal domain-like 0.000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000451   Gene: ENSPPYG00000000397   Transcript: ENSPPYT00000000470
Sequence length 538
Comment pep:known_by_projection chromosome:PPYG2:1:57240879:57274350:-1 gene:ENSPPYG00000000397 transcript:ENSPPYT00000000470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEA
LIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCR
IPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHK
DLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSMETEKLLKYLEAVEKVKRTRD
ELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSE
VSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKT
FKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMV
PCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPA
IALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTLDMI
Download sequence
Identical sequences H2N4C0
ENSPPYP00000000451 ENSPPYP00000000451 XP_002809723.2.23681 XP_009238102.1.23681 XP_009238111.1.23681 XP_009238115.1.23681 XP_009238120.1.23681 XP_009238125.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]