SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000493 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000493
Domain Number 1 Region: 60-192
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-47
Family Regulator of G-protein signaling, RGS 0.0000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000493   Gene: ENSPPYG00000000433   Transcript: ENSPPYT00000000513
Sequence length 198
Comment pep:known_by_projection chromosome:PPYG2:1:68020989:68067838:1 gene:ENSPPYG00000000433 transcript:ENSPPYT00000000513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSTLTRSLSDHPVGKDPQAMRTGQRQNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRAL
KRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLV
SKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRF
LRSKMYLDLLSQSQRRLS
Download sequence
Identical sequences A0A2I2Y2A0 A0A2I3TN73 H2N4F7
ENSGGOP00000002613 ENSPPYP00000000493 ENSPPYP00000000493 XP_009238537.1.23681 XP_009437615.1.37143 XP_009437623.1.37143 XP_009437628.1.37143 XP_016789305.1.37143 XP_018883136.1.27298 ENSGGOP00000002613 9598.ENSPTRP00000002934 9600.ENSPPYP00000000493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]