SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000649 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000649
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.0000000196
Family HMG-box 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000000649
Domain Number - Region: 167-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00117
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000649   Gene: ENSPPYG00000000555   Transcript: ENSPPYT00000000674
Sequence length 434
Comment pep:known_by_projection chromosome:PPYG2:1:84198896:84246140:-1 gene:ENSPPYG00000000555 transcript:ENSPPYT00000000674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWALLREEEKEKYAEMARE
WRAAQGKDSGPSEKQKPVFTPLRRPGMLVPKQNVSPPDMSTLSLKGDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGKIPRGFRFHCQAASDSSHK
IPISNFERGHNQATVLQNLYRFIHPNPGNWPPIYCKSDDRTRVNWCLKHMAKASEIRQDL
QLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFSHFN
SSNQEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFANCDTSLSPY
MSQKDGYKSFSSLS
Download sequence
Identical sequences H2N4W0
9600.ENSPPYP00000000649 ENSPPYP00000000649 ENSPPYP00000000649 XP_002809887.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]