SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000734 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000734
Domain Number 1 Region: 75-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000734   Gene: ENSPPYG00000000632   Transcript: ENSPPYT00000000763
Sequence length 133
Comment pep:known_by_projection chromosome:PPYG2:1:90996952:90997353:-1 gene:ENSPPYG00000000632 transcript:ENSPPYT00000000763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEAGRKDLQH
LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
Download sequence
Identical sequences H2N542
ENSPPYP00000000734 XP_002809965.1.23681 ENSPPYP00000000734 9600.ENSPPYP00000000734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]