SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000817 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000817
Domain Number 1 Region: 180-341
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.63e-34
Family DnaQ-like 3'-5' exonuclease 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000817   Gene: ENSPPYG00000000706   Transcript: ENSPPYT00000000848
Sequence length 354
Comment pep:known_by_projection chromosome:PPYG2:1:94781867:94787863:1 gene:ENSPPYG00000000706 transcript:ENSPPYT00000000848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPIKAPKLHSEPPK
KGETPTVDGTWKTPSFPKKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLL
GEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPWKM
VAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVN
ATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENA
TMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEAEWEEHLARNPPTD
Download sequence
Identical sequences H2N5C1
9600.ENSPPYP00000000817 ENSPPYP00000000817 XP_009241172.1.23681 XP_009241178.1.23681 XP_009241187.1.23681 XP_009241190.1.23681 XP_009241198.1.23681 XP_009241205.1.23681 ENSPPYP00000000817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]