SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000000844 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000000844
Domain Number 1 Region: 51-449
Classification Level Classification E-value
Superfamily Sema domain 1.7e-127
Family Sema domain 0.000000066
Further Details:      
 
Domain Number 2 Region: 445-496
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000419
Family Plexin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000000844   Gene: ENSPPYG00000000727   Transcript: ENSPPYT00000000875
Sequence length 709
Comment pep:known_by_projection chromosome:PPYG2:1:95322890:95350735:-1 gene:ENSPPYG00000000727 transcript:ENSPPYT00000000875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGRQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKS
GVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRN
LQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNL
NSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALAAYYW
SHGPAAVPEASSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDP
ELADIPREHVKVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALIILLASPLRALR
ARGKVQGCETLRPGEKAPLSREQHLQSPKECRTSASDVDADDCLGTEVA
Download sequence
Identical sequences H2N5E8
ENSPPYP00000000844 ENSPPYP00000000844 9600.ENSPPYP00000000844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]